PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv6_129710_qrxi.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family MIKC_MADS
Protein Properties Length: 235aa    MW: 27193.8 Da    PI: 9.8656
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv6_129710_qrxi.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF80.21.4e-25960150
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T..TSEEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifss..tgklyeys 50
                        krien++nrqvtfskRrngi+KKA+EL vLCda++++ii+ss  t ++y y+
  Bv6_129710_qrxi.t1  9 KRIENTTNRQVTFSKRRNGIMKKAQELTVLCDAKISLIIVSSssTKRVYHYI 60
                        79*************************************9861155677775 PP

2K-box66.96.9e-2373169197
               K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 
                         yqk +g++l+ +++e++q++ +kL + + +L+re+ +++G dLe+Ls+ eL  L+qq+ ++   iR++K++++++q+ +++kk ++l+e+ 
  Bv6_129710_qrxi.t1  73 YQKVEGVDLWRKHYEQMQEQERKLLDINTELRREISRRMGGDLEELSIGELGALQQQMSDARLVIRDRKYHVIKNQTGTTRKKVRSLEEIR 163
                         89999*************************************************************************************9 PP

               K-box  92 kaLrkk 97 
                          +L  +
  Bv6_129710_qrxi.t1 164 DNLLLN 169
                         999765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-35162IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.118152IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.19E-33295IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-23323IPR002100Transcription factor, MADS-box
PfamPF003198.2E-221059IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-232338IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-233859IPR002100Transcription factor, MADS-box
PfamPF014861.1E-1284168IPR002487Transcription factor, K-box
PROSITE profilePS5129712.80386176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MGRGKLEIKR IENTTNRQVT FSKRRNGIMK KAQELTVLCD AKISLIIVSS SSTKRVYHYI  60
SPGVSLKKMY DEYQKVEGVD LWRKHYEQMQ EQERKLLDIN TELRREISRR MGGDLEELSI  120
GELGALQQQM SDARLVIRDR KYHVIKNQTG TTRKKVRSLE EIRDNLLLNL ETRFKAPEFG  180
LEDDNNQGVY EDAANYANNG AAANLFGVSR HSRHHNFQQA QAGCYSINFQ DLRLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P7e-15173172Myocyte-specific enhancer factor 2B
1tqe_Q7e-15173172Myocyte-specific enhancer factor 2B
1tqe_R7e-15173172Myocyte-specific enhancer factor 2B
1tqe_S7e-15173172Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010679828.11e-175PREDICTED: MADS-box protein CMB2-like
SwissprotQ424981e-100CMB2_DIACA; MADS-box protein CMB2
TrEMBLA0A0J8CC241e-175A0A0J8CC24_BETVU; Uncharacterized protein
STRINGVIT_04s0023g02820.t011e-78(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.12e-59MIKC_MADS family protein